Lineage for d4yruc_ (4yru C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711776Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (3 PDB entries)
  8. 2711785Domain d4yruc_: 4yru C: [271145]
    automated match to d1ikua_
    complexed with ca

Details for d4yruc_

PDB Entry: 4yru (more details), 2.8 Å

PDB Description: crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus
PDB Compounds: (C:) neuronal calcium sensor 1

SCOPe Domain Sequences for d4yruc_:

Sequence, based on SEQRES records: (download)

>d4yruc_ a.39.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf
vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda
iyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegsk

Sequence, based on observed residues (ATOM records): (download)

>d4yruc_ a.39.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfildaagfqkiykqffpfgdptkfatfvfnvfde
nkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyqmvgn
tvelntpekrvdrifammdknadgkltlqefqegsk

SCOPe Domain Coordinates for d4yruc_:

Click to download the PDB-style file with coordinates for d4yruc_.
(The format of our PDB-style files is described here.)

Timeline for d4yruc_: