SCOPe 2.05: Domain d4yrud_: 4yru D:

Lineage for d4yrud_ (4yru D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [238064] (2 PDB entries)

8. Domain d4yrud_: 4yru D: [271143]
   automated match to d1ikua_
   complexed with ca

Details for d4yrud_

PDB Entry: 4yru, 2.8 Å

PDB Description: crystal structure of c-terminally truncated neuronal calcium sensor (ncs-1) from rattus norvegicus

PDB Compounds: (D:) neuronal calcium sensor 1

SCOPe Domain Sequences for d4yrud_:

Sequence, based on SEQRES records:

>d4yrud_ a.39.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfikdcpsgqldaagfqkiykqffpfgdptkfatf
vfnvfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivda
iyqmvgntvelpeeentpekrvdrifammdknadgkltlqefqegs

Sequence, based on observed residues (ATOM records):

>d4yrud_ a.39.1.0 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lkpevveeltrktyftekevqqwykgfikdcpldaagfqkiykqffpfgdptkfatfvfn
vfdenkdgriefsefiqalsvtsrgtldeklrwafklydldndgyitrnemldivdaiyq
mvgntvelpeeentpekrvdrifammdknadgkltlqefqegs

Timeline for d4yrud_:

• d4yrud_ is new in SCOPe 2.05-stable
  
• d4yrud_ appears in SCOPe 2.06
  
• d4yrud_ appears in the current release, SCOPe 2.08