Lineage for d1ew3a_ (1ew3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804405Protein Lipocalin allergen [50824] (2 species)
  7. 2804410Species Horse (Equus caballus), equ c 1 [TaxId:9796] [50826] (1 PDB entry)
  8. 2804411Domain d1ew3a_: 1ew3 A: [27114]

Details for d1ew3a_

PDB Entry: 1ew3 (more details), 2.3 Å

PDB Description: crystal structure of the major horse allergen equ c 1
PDB Compounds: (A:) allergen equ c 1

SCOPe Domain Sequences for d1ew3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]}
vairnfdiskisgewysiflasdvkekieengsmrvfvdviraldnsslyaeyqtkvnge
ctefpmvfdkteedgvyslnydgynvfrisefendehiilylvnfdkdrpfqlfefyare
pdvspeikeefvkivqkrgivkeniidltkidrcfqlrg

SCOPe Domain Coordinates for d1ew3a_:

Click to download the PDB-style file with coordinates for d1ew3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ew3a_: