Lineage for d4yl8a2 (4yl8 A:88-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697492Protein Moesin [47033] (2 species)
  7. 2697498Species Mouse (Mus musculus) [TaxId:10090] [311103] (1 PDB entry)
  8. 2697499Domain d4yl8a2: 4yl8 A:88-198 [271136]
    Other proteins in same PDB: d4yl8a1, d4yl8a3
    automated match to d2zpya1
    complexed with gol, iod

Details for d4yl8a2

PDB Entry: 4yl8 (more details), 1.5 Å

PDB Description: crystal structure of the crumbs/moesin complex
PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d4yl8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl8a2 a.11.2.1 (A:88-198) Moesin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

SCOPe Domain Coordinates for d4yl8a2:

Click to download the PDB-style file with coordinates for d4yl8a2.
(The format of our PDB-style files is described here.)

Timeline for d4yl8a2: