Lineage for d4yl8a1 (4yl8 A:1-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932854Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 2932876Protein Moesin [54257] (2 species)
  7. 2932882Species Mouse (Mus musculus) [TaxId:10090] [311111] (1 PDB entry)
  8. 2932883Domain d4yl8a1: 4yl8 A:1-87 [271135]
    Other proteins in same PDB: d4yl8a2, d4yl8a3
    automated match to d1gc7a3
    complexed with gol, iod

Details for d4yl8a1

PDB Entry: 4yl8 (more details), 1.5 Å

PDB Description: crystal structure of the crumbs/moesin complex
PDB Compounds: (A:) moesin

SCOPe Domain Sequences for d4yl8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yl8a1 d.15.1.4 (A:1-87) Moesin {Mouse (Mus musculus) [TaxId: 10090]}
mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkafstwlk
lnkkvtaqdvrkespllfkfrakfype

SCOPe Domain Coordinates for d4yl8a1:

Click to download the PDB-style file with coordinates for d4yl8a1.
(The format of our PDB-style files is described here.)

Timeline for d4yl8a1: