![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
![]() | Protein Moesin [54257] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [311111] (1 PDB entry) |
![]() | Domain d4yl8a1: 4yl8 A:1-87 [271135] Other proteins in same PDB: d4yl8a2, d4yl8a3 automated match to d1gc7a3 complexed with gol, iod |
PDB Entry: 4yl8 (more details), 1.5 Å
SCOPe Domain Sequences for d4yl8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yl8a1 d.15.1.4 (A:1-87) Moesin {Mouse (Mus musculus) [TaxId: 10090]} mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkafstwlk lnkkvtaqdvrkespllfkfrakfype
Timeline for d4yl8a1: