SCOPe 2.08: Domain d4yeer1: 4yee R:75-156

Lineage for d4yeer1 (4yee R:75-156)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries)

8. Domain d4yeer1: 4yee R:75-156 [271131]
   Other proteins in same PDB: d4yeeb2, d4yeec2, d4yeee2, d4yeef2, d4yeeg2, d4yeeh2, d4yeei2, d4yeej2, d4yeem2, d4yeen2, d4yeeo2, d4yeep2, d4yeeq2, d4yeer2
   automated match to d2f15a1
   complexed with gol

Details for d4yeer1

PDB Entry: 4yee, 2 Å

PDB Description: beta2 carbohydrate binding module (cbm) of amp-activated protein kinase (ampk) in complex with glucosyl-beta-cyclodextrin

PDB Compounds: (R:) 5'-amp-activated protein kinase subunit beta-2

SCOPe Domain Sequences for d4yeer1:

Sequence; same for both SEQRES and ATOM records:

>d4yeer1 b.1.18.21 (R:75-156) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
hdpsepvvtsqlgtinnlihvk

Timeline for d4yeer1:

• d4yeer1 first appeared in SCOPe 2.05, called d4yeer_
  
• d4yeer1 appears in SCOPe 2.07