Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255461] (4 PDB entries) |
Domain d4yeer1: 4yee R:75-156 [271131] Other proteins in same PDB: d4yeeb2, d4yeec2, d4yeee2, d4yeef2, d4yeeg2, d4yeeh2, d4yeei2, d4yeej2, d4yeem2, d4yeen2, d4yeeo2, d4yeep2, d4yeeq2, d4yeer2 automated match to d2f15a1 complexed with gol |
PDB Entry: 4yee (more details), 2 Å
SCOPe Domain Sequences for d4yeer1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yeer1 b.1.18.21 (R:75-156) 5'-AMP-activated protein kinase subunit beta-2 {Norway rat (Rattus norvegicus) [TaxId: 10116]} qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv hdpsepvvtsqlgtinnlihvk
Timeline for d4yeer1:
View in 3D Domains from other chains: (mouse over for more information) d4yeea_, d4yeeb1, d4yeeb2, d4yeec1, d4yeec2, d4yeed_, d4yeee1, d4yeee2, d4yeef1, d4yeef2, d4yeeg1, d4yeeg2, d4yeeh1, d4yeeh2, d4yeei1, d4yeei2, d4yeej1, d4yeej2, d4yeek_, d4yeel_, d4yeem1, d4yeem2, d4yeen1, d4yeen2, d4yeeo1, d4yeeo2, d4yeep1, d4yeep2, d4yeeq1, d4yeeq2 |