Lineage for d1hqpa_ (1hqp A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Odorant-binding protein [50821] (2 species) Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries) 
Domain d1hqpa_: 1hqp A: [27112]
Details for d1hqpa_
PDB Entry: 1hqp (more details), 2.3 Å
PDB Description: crystal structure of a truncated form of porcine odorant-binding protein
SCOP Domain Sequences for d1hqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqpa_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa)}
pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
lekfkevtrengipeenivniierddcpa
SCOP Domain Coordinates for d1hqpa_:
Click to download the PDB-style file with coordinates for d1hqpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hqpa_:
- d1hqpa_ appears in SCOP 1.57
- d1hqpa_ appears in the current release, SCOPe 2.08
View in 3D