Lineage for d4xqof_ (4xqo F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3042016Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries)
  8. 3042034Domain d4xqof_: 4xqo F: [271102]
    Other proteins in same PDB: d4xqoa_, d4xqoc_, d4xqoe_
    automated match to d4uo4b_
    complexed with nag

Details for d4xqof_

PDB Entry: 4xqo (more details), 2.85 Å

PDB Description: crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-sln
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xqof_:

Sequence, based on SEQRES records: (download)

>d4xqof_ h.3.1.0 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records): (download)

>d4xqof_ h.3.1.0 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqaadykstqaaidqitgklnrlvekntefesi
esefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrkql
rqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4xqof_:

Click to download the PDB-style file with coordinates for d4xqof_.
(The format of our PDB-style files is described here.)

Timeline for d4xqof_: