Lineage for d1a3ya_ (1a3y A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16530Protein Odorant-binding protein [50821] (2 species)
  7. 16536Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)
  8. 16551Domain d1a3ya_: 1a3y A: [27110]

Details for d1a3ya_

PDB Entry: 1a3y (more details), 2.25 Å

PDB Description: odorant binding protein from nasal mucosa of pig

SCOP Domain Sequences for d1a3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3ya_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa)}
pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
lekfkevtrengipeenivniierddcpa

SCOP Domain Coordinates for d1a3ya_:

Click to download the PDB-style file with coordinates for d1a3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1a3ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a3yb_