Lineage for d4xqod_ (4xqo D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2267706Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2267707Protein automated matches [254645] (23 species)
    not a true protein
  7. 2267775Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries)
  8. 2267788Domain d4xqod_: 4xqo D: [271099]
    Other proteins in same PDB: d4xqoa_, d4xqoc_, d4xqoe_
    automated match to d4uo4b_
    complexed with gal, nag, sia

Details for d4xqod_

PDB Entry: 4xqo (more details), 2.85 Å

PDB Description: crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xqod_:

Sequence, based on SEQRES records: (download)

>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records): (download)

>d4xqod_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwyfrhqnaqgtgqaadykstqaaidqitgklnrlventefe
siesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervrk
qlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4xqod_:

Click to download the PDB-style file with coordinates for d4xqod_.
(The format of our PDB-style files is described here.)

Timeline for d4xqod_: