Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (23 species) not a true protein |
Species Influenza a virus [TaxId:1458555] [271092] (2 PDB entries) |
Domain d4xq5e_: 4xq5 E: [271098] Other proteins in same PDB: d4xq5b_, d4xq5d_, d4xq5f_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4xq5 (more details), 2.59 Å
SCOPe Domain Sequences for d4xq5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xq5e_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 1458555]} dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnrrslmlatgmrnvpe
Timeline for d4xq5e_: