SCOPe 2.05: Domain d4xq5f_: 4xq5 F:

Lineage for d4xq5f_ (4xq5 F:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (10 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries)

8. Domain d4xq5f_: 4xq5 F: [271097]
   Other proteins in same PDB: d4xq5a_, d4xq5c_, d4xq5e_
   automated match to d4uo4b_
   complexed with nag

Details for d4xq5f_

PDB Entry: 4xq5, 2.59 Å

PDB Description: human-infecting h10n8 influenza virus retains strong preference for avian-type receptors

PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xq5f_:

Sequence, based on SEQRES records:

>d4xq5f_ h.3.1.0 (F:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records):

>d4xq5f_ h.3.1.0 (F:) automated matches {Influenza A virus [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtqaadykstqaaidqitgklnrlvektnte
fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv
rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d4xq5f_:

• d4xq5f_ is new in SCOPe 2.05-stable
  
• d4xq5f_ appears in SCOPe 2.06
  
• d4xq5f_ appears in the current release, SCOPe 2.08