![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
![]() | Protein automated matches [254645] (42 species) not a true protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [255657] (9 PDB entries) |
![]() | Domain d4xq5f_: 4xq5 F: [271097] Other proteins in same PDB: d4xq5a_, d4xq5c_, d4xq5e_ automated match to d4uo4b_ complexed with nag |
PDB Entry: 4xq5 (more details), 2.59 Å
SCOPe Domain Sequences for d4xq5f_:
Sequence, based on SEQRES records: (download)
>d4xq5f_ h.3.1.0 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]} lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
>d4xq5f_ h.3.1.0 (F:) automated matches {Influenza A virus, different strains [TaxId: 11320]} lfgaiagflengwegmvdgwygfrhqnaqgtqaadykstqaaidqitgklnrlvektnte fesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyerv rkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d4xq5f_: