Lineage for d4xqob_ (4xqo B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (24 species)
    not a true protein
  7. 2592447Species Influenza A virus, different strains [TaxId:11320] [255657] (7 PDB entries)
  8. 2592459Domain d4xqob_: 4xqo B: [271096]
    Other proteins in same PDB: d4xqoa_, d4xqoc_, d4xqoe_
    automated match to d4uo4b_
    complexed with gal, nag, sia

Details for d4xqob_

PDB Entry: 4xqo (more details), 2.85 Å

PDB Description: crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-sln
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xqob_:

Sequence, based on SEQRES records: (download)

>d4xqob_ h.3.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records): (download)

>d4xqob_ h.3.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvtntef
esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4xqob_:

Click to download the PDB-style file with coordinates for d4xqob_.
(The format of our PDB-style files is described here.)

Timeline for d4xqob_: