SCOPe 2.07: Domain d4xqoe_: 4xqo E:

Lineage for d4xqoe_ (4xqo E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus [TaxId:1458555] [271092] (2 PDB entries)

8. Domain d4xqoe_: 4xqo E: [271095]
   Other proteins in same PDB: d4xqob_, d4xqod_, d4xqof_
   automated match to d1rd8a_
   complexed with gal, nag, sia

Details for d4xqoe_

PDB Entry: 4xqo, 2.85 Å

PDB Description: crystal structure of hemagglutinin from jiangxi-donghu (2013) h10n8 influenza virus in complex with 6'-sln

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4xqoe_:

Sequence; same for both SEQRES and ATOM records:

>d4xqoe_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 1458555]}
dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml
igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss
insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss
tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh
nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk
yvnrrslmlatgmrnvpe

Timeline for d4xqoe_:

• d4xqoe_ first appeared in SCOPe 2.05
  
• d4xqoe_ appears in SCOPe 2.06
  
• d4xqoe_ appears in the current release, SCOPe 2.08