![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus [TaxId:1458555] [271092] (2 PDB entries) |
![]() | Domain d4xq5c_: 4xq5 C: [271094] Other proteins in same PDB: d4xq5b_, d4xq5d_, d4xq5f_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4xq5 (more details), 2.59 Å
SCOPe Domain Sequences for d4xq5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xq5c_ b.19.1.0 (C:) automated matches {Influenza A virus [TaxId: 1458555]} dkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigml igtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygss insagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnrrslmlatgmrnvpel
Timeline for d4xq5c_: