SCOPe 2.07: Domain d4xq5d_: 4xq5 D:

Lineage for d4xq5d_ (4xq5 D:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (35 species)
   not a true protein

7. Species Influenza A virus [TaxId:1458555] [271089] (1 PDB entry)

8. Domain d4xq5d_: 4xq5 D: [271090]
   Other proteins in same PDB: d4xq5a_, d4xq5c_, d4xq5e_
   automated match to d4uo4b_
   complexed with nag

Details for d4xq5d_

PDB Entry: 4xq5, 2.59 Å

PDB Description: human-infecting h10n8 influenza virus retains strong preference for avian-type receptors

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xq5d_:

Sequence, based on SEQRES records:

>d4xq5d_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 1458555]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektnt
efesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyer
vrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Sequence, based on observed residues (ATOM records):

>d4xq5d_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 1458555]}
lfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektef
esiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlyervr
kqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

Timeline for d4xq5d_:

• d4xq5d_ first appeared in SCOPe 2.05
  
• d4xq5d_ appears in SCOPe 2.06