SCOPe 2.03: Domain d1e02b_: 1e02 B:

Lineage for d1e02b_ (1e02 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)

8. Domain d1e02b_: 1e02 B: [27109]
   complexed with una

Details for d1e02b_

PDB Entry: 1e02, 2.15 Å

PDB Description: porcine odorant binding protein complexed with undecanal

PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1e02b_:

Sequence; same for both SEQRES and ATOM records:

>d1e02b_ b.60.1.1 (B:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
kfkevtrengipeenivniierddcpa

Timeline for d1e02b_:

• d1e02b_ first appeared (with stable ids) in SCOP 1.55
  
• d1e02b_ appears in SCOPe 2.02
  
• d1e02b_ appears in SCOPe 2.04
  
• d1e02b_ appears in the current release, SCOPe 2.08