Lineage for d4xeyb1 (4xey B:141-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965879Domain d4xeyb1: 4xey B:141-238 [271086]
    Other proteins in same PDB: d4xeya_, d4xeyb2
    automated match to d1opla2
    complexed with 1n1

Details for d4xeyb1

PDB Entry: 4xey (more details), 2.89 Å

PDB Description: crystal structure of an sh2-kinase domain construct of c-abl tyrosine kinase
PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4xeyb1:

Sequence, based on SEQRES records: (download)

>d4xeyb1 d.93.1.0 (B:141-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
gklyvssesrfntlaelvhhhstvadglittlhypapk

Sequence, based on observed residues (ATOM records): (download)

>d4xeyb1 d.93.1.0 (B:141-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
gklyvsrfntlaelvhhhstvadglittlhypapk

SCOPe Domain Coordinates for d4xeyb1:

Click to download the PDB-style file with coordinates for d4xeyb1.
(The format of our PDB-style files is described here.)

Timeline for d4xeyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xeyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4xeya_