SCOPe 2.06: Domain d4xkga_: 4xkg A:

Lineage for d4xkga_ (4xkg A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus [TaxId:119212] [270847] (8 PDB entries)

8. Domain d4xkga_: 4xkg A: [271075]
   Other proteins in same PDB: d4xkgb_, d4xkgd_, d4xkgf_
   automated match to d3gbna_
   complexed with gal, nag, sia

Details for d4xkga_

PDB Entry: 4xkg, 2.25 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus in complex with 6'-sln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4xkga_:

Sequence; same for both SEQRES and ATOM records:

>d4xkga_ b.19.1.0 (A:) automated matches {Influenza a virus [TaxId: 119212]}
pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg
etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
plwigecpkyvkseslrlatglrnvpqiat

Timeline for d4xkga_:

• d4xkga_ first appeared in SCOPe 2.05
  
• d4xkga_ appears in SCOPe 2.07
  
• d4xkga_ appears in the current release, SCOPe 2.08