Lineage for d4xkdb_ (4xkd B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267237Domain d4xkdb_: 4xkd B: [271074]
    Other proteins in same PDB: d4xkda_, d4xkdc_, d4xkde_
    automated match to d4h32b_
    complexed with nag

Details for d4xkdb_

PDB Entry: 4xkd (more details), 2.48 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xkdb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

SCOPe Domain Coordinates for d4xkdb_:

Click to download the PDB-style file with coordinates for d4xkdb_.
(The format of our PDB-style files is described here.)

Timeline for d4xkdb_: