![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus h6n1 subtype [TaxId:119212] [269451] (9 PDB entries) |
![]() | Domain d4xkee_: 4xke E: [271072] Other proteins in same PDB: d4xkeb_, d4xked_, d4xkef_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4xke (more details), 2.36 Å
SCOPe Domain Sequences for d4xkee_:
Sequence, based on SEQRES records: (download)
>d4xkee_ b.19.1.0 (E:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]} pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs plwigecpkyvkseslrlatglrnvpq
>d4xkee_ b.19.1.0 (E:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]} pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpg etlnvesngnliapwyaykfvskkgavfksdlpiencdatcqtitgvlrtnktfqnvspl wigecpkyvkseslrlatglrnvpq
Timeline for d4xkee_: