Lineage for d1e06b_ (1e06 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Odorant-binding protein [50821] (2 species) Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries) 
Domain d1e06b_: 1e06 B: [27107]
Details for d1e06b_
PDB Entry: 1e06 (more details), 2.12 Å
PDB Description: porcine odorant binding protein complexed with 5-methyl-2-(1-methylethyl)phenol
SCOP Domain Sequences for d1e06b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e06b_ b.60.1.1 (B:) Odorant-binding protein {Pig (Sus scrofa)}
elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
kfkevtrengipeenivniierddcpa
SCOP Domain Coordinates for d1e06b_:
Click to download the PDB-style file with coordinates for d1e06b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e06b_:
- d1e06b_ appears in SCOP 1.57
- d1e06b_ appears in the current release, SCOPe 2.08
View in 3D
