Lineage for d4xked_ (4xke D:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969777Domain d4xked_: 4xke D: [271069]
    Other proteins in same PDB: d4xkea_, d4xkec_, d4xkee_
    automated match to d4h32b_
    complexed with gal, nag, sia

Details for d4xked_

PDB Entry: 4xke (more details), 2.36 Å

PDB Description: crystal structure of hemagglutinin from taiwan (2013) h6n1 influenza virus in complex with 3'-sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4xked_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xked_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

SCOPe Domain Coordinates for d4xked_:

Click to download the PDB-style file with coordinates for d4xked_.
(The format of our PDB-style files is described here.)

Timeline for d4xked_: