Lineage for d4xfma_ (4xfm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152074Fold c.146: YgbK-like [142763] (1 superfamily)
    consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands
  4. 2152075Superfamily c.146.1: YgbK-like [142764] (2 families) (S)
  5. 2152085Family c.146.1.0: automated matches [271064] (1 protein)
    not a true family
  6. 2152086Protein automated matches [271065] (2 species)
    not a true protein
  7. 2152090Species Pectobacterium atrosepticum [TaxId:218491] [271066] (2 PDB entries)
  8. 2152091Domain d4xfma_: 4xfm A: [271067]
    automated match to d3dqqb_
    complexed with the

Details for d4xfma_

PDB Entry: 4xfm (more details), 1.55 Å

PDB Description: crystal structure of a domain of unknown function (duf1537) from pectobacterium atrosepticum (eca3761), target efi-511609, with bound d-threonate, domain swapped dimer
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4xfma_:

Sequence, based on SEQRES records: (download)

>d4xfma_ c.146.1.0 (A:) automated matches {Pectobacterium atrosepticum [TaxId: 218491]}
gqvlvvaddftgandagvglaqhgarvsvvfdvntlhadllgdavvintdsraarddvas
qrtaaavaawqavggkgwiikkidstlrgnlgaevaaalsaadvpvaliaaasptlgrvt
rqgevwvngrrltdtefasdpktpvtsasiaarlaeqtalpvaeihldevrqanlahrlq
qladegtrliildtdvqddlthivnaaralpfrpllvgsaglsdalataqdftrktekpl
lavvgsmsdiaqkqiaaarlrsdvtlveidinalfspdsstvmasqcedalkaltnghhc
iirtchnenqrfeidarcrelglsrqqlgetishylgeltrsivqaldslaadgtrrrlp
gglylsggdiaiavatalgatgfqikgqiascvpwgyllnsivgmtpvmtkaggfgnett
lldvlrfieek

Sequence, based on observed residues (ATOM records): (download)

>d4xfma_ c.146.1.0 (A:) automated matches {Pectobacterium atrosepticum [TaxId: 218491]}
gqvlvvaddftgandagvglaqhgarvsvvfdvntlhadllgdavvintdsraarddvas
qrtaaavaawqavggkgwiikkidstlrgnlgaevaaalsaadvpvaliaaasptlgrvt
rqgevwvngrrltdtefasdpktpvtsasiaarlaeqtalpvaeihldevrqanlahrlq
qladegtrliildtdvqddlthivnaaralpfrpllvgsaglsdalataqdftrktekpl
lavvgsmsdiaqkqiaaarlrsdvtlveidinalfspdsstvmasqcedalkaltnghhc
iirtcqqlgetishylgeltrsivqallpgglylsggdiaiavatalgatgfqikgqias
cvpwgyllnsivgmtpvmtkaggfgnettlldvlrfieek

SCOPe Domain Coordinates for d4xfma_:

Click to download the PDB-style file with coordinates for d4xfma_.
(The format of our PDB-style files is described here.)

Timeline for d4xfma_: