Lineage for d1e06a_ (1e06 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072362Protein Odorant-binding protein [50821] (2 species)
    C-termini swapping dimer
  7. 2072380Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)
  8. 2072389Domain d1e06a_: 1e06 A: [27106]
    complexed with ipb

Details for d1e06a_

PDB Entry: 1e06 (more details), 2.12 Å

PDB Description: porcine odorant binding protein complexed with 5-methyl-2-(1-methylethyl)phenol
PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d1e06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e06a_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
lekfkevtrengipeenivniierddcpa

SCOPe Domain Coordinates for d1e06a_:

Click to download the PDB-style file with coordinates for d1e06a_.
(The format of our PDB-style files is described here.)

Timeline for d1e06a_: