Lineage for d3wsab_ (3wsa B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010672Family a.128.1.2: Squalene synthase [48580] (2 protein domains)
    automatically mapped to Pfam PF00494
  6. 2010678Protein automated matches [191305] (1 species)
    not a true protein
  7. 2010679Species Human (Homo sapiens) [TaxId:9606] [190011] (24 PDB entries)
  8. 2010760Domain d3wsab_: 3wsa B: [271059]
    automated match to d3vjbc_
    complexed with rwz

Details for d3wsab_

PDB Entry: 3wsa (more details), 2.9 Å

PDB Description: the tuberculosis drug sq109 inhibits trypanosoma cruzi cell proliferation and acts synergistically with posaconazole
PDB Compounds: (B:) Squalene synthase

SCOPe Domain Sequences for d3wsab_:

Sequence, based on SEQRES records: (download)

>d3wsab_ a.128.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
tniirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdv
itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavlirlgqavtlmmdatnmpa
vkaiiyqymeeiyhripdsnpsssktrqiistirtq

Sequence, based on observed residues (ATOM records): (download)

>d3wsab_ a.128.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dslssslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
tniirdyledqqggrefwpqevwsryvkklgdfalpenidlavqclnelitnalhhipdv
itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavliavtlmmdatnmpavkai
iyqymeeiyhripdsnpsssktrqiistirtq

SCOPe Domain Coordinates for d3wsab_:

Click to download the PDB-style file with coordinates for d3wsab_.
(The format of our PDB-style files is described here.)

Timeline for d3wsab_: