Lineage for d4w58a1 (4w58 A:1-164)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2172372Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2173043Protein automated matches [193860] (2 species)
    not a true protein
  7. 2173044Species Enterobacteria phage [TaxId:10665] [193861] (22 PDB entries)
  8. 2173065Domain d4w58a1: 4w58 A:1-164 [271050]
    Other proteins in same PDB: d4w58a2
    automated match to d3lzma_
    complexed with 3h2, epe

Details for d4w58a1

PDB Entry: 4w58 (more details), 1.8 Å

PDB Description: t4 lysozyme l99a with n-pentylbenzene bound
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d4w58a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w58a1 d.2.1.3 (A:1-164) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d4w58a1:

Click to download the PDB-style file with coordinates for d4w58a1.
(The format of our PDB-style files is described here.)

Timeline for d4w58a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4w58a2