SCOPe 2.08: Domain d4w58a1: 4w58 A:1-164

Lineage for d4w58a1 (4w58 A:1-164)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein automated matches [193860] (2 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:10665] [193861] (21 PDB entries)

8. Domain d4w58a1: 4w58 A:1-164 [271050]
   Other proteins in same PDB: d4w58a2
   automated match to d3lzma_
   complexed with 3h2, epe

Details for d4w58a1

PDB Entry: 4w58, 1.8 Å

PDB Description: t4 lysozyme l99a with n-pentylbenzene bound

PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d4w58a1:

Sequence; same for both SEQRES and ATOM records:

>d4w58a1 d.2.1.3 (A:1-164) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d4w58a1:

• d4w58a1 first appeared in SCOPe 2.05, called d4w58a_
  
• d4w58a1 appears in SCOPe 2.07