Lineage for d1dzmb_ (1dzm B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16530Protein Odorant-binding protein [50821] (2 species)
  7. 16536Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)
  8. 16546Domain d1dzmb_: 1dzm B: [27105]

Details for d1dzmb_

PDB Entry: 1dzm (more details), 1.93 Å

PDB Description: porcine odorant binding protein complexed with benzoic acid phenylmethylester

SCOP Domain Sequences for d1dzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzmb_ b.60.1.1 (B:) Odorant-binding protein {Pig (Sus scrofa)}
elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
kfkevtrengipeenivniierddcpa

SCOP Domain Coordinates for d1dzmb_:

Click to download the PDB-style file with coordinates for d1dzmb_.
(The format of our PDB-style files is described here.)

Timeline for d1dzmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dzma_