Lineage for d4w59a_ (4w59 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2171118Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2171119Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2172372Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2173043Protein automated matches [193860] (2 species)
    not a true protein
  7. 2173044Species Enterobacteria phage [TaxId:10665] [193861] (22 PDB entries)
  8. 2173046Domain d4w59a_: 4w59 A: [271044]
    automated match to d3lzma_
    complexed with 3gz, epe

Details for d4w59a_

PDB Entry: 4w59 (more details), 1.39 Å

PDB Description: t4 lysozyme l99a with n-hexylbenzene bound
PDB Compounds: (A:) endolysin

SCOPe Domain Sequences for d4w59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w59a_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOPe Domain Coordinates for d4w59a_:

Click to download the PDB-style file with coordinates for d4w59a_.
(The format of our PDB-style files is described here.)

Timeline for d4w59a_: