![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.3: Phage lysozyme [53981] (4 proteins) |
![]() | Protein automated matches [193860] (2 species) not a true protein |
![]() | Species Enterobacteria phage [TaxId:10665] [193861] (21 PDB entries) |
![]() | Domain d4w59a_: 4w59 A: [271044] automated match to d3lzma_ complexed with 3gz, epe |
PDB Entry: 4w59 (more details), 1.39 Å
SCOPe Domain Sequences for d4w59a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w59a_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 10665]} mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
Timeline for d4w59a_: