Lineage for d4tzia_ (4tzi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965668Protein automated matches [190202] (2 species)
    not a true protein
  7. 2965692Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries)
  8. 2965702Domain d4tzia_: 4tzi A: [271043]
    automated match to d1blka_

Details for d4tzia_

PDB Entry: 4tzi (more details), 2.1 Å

PDB Description: structure of unliganded lyn sh2 domain
PDB Compounds: (A:) tyrosine-protein kinase lyn

SCOPe Domain Sequences for d4tzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tzia_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
akvntleteewffkditrkdaerqllapgnsagafliresetlkgsfslsvrdydpmhgd
vikhykirsldnggyyispritfpcisdmikhyqkqsdglcrrlekacis

SCOPe Domain Coordinates for d4tzia_:

Click to download the PDB-style file with coordinates for d4tzia_.
(The format of our PDB-style files is described here.)

Timeline for d4tzia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4tzib_