Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein automated matches [190202] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries) |
Domain d4tzia_: 4tzi A: [271043] automated match to d1blka_ |
PDB Entry: 4tzi (more details), 2.1 Å
SCOPe Domain Sequences for d4tzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tzia_ d.93.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} akvntleteewffkditrkdaerqllapgnsagafliresetlkgsfslsvrdydpmhgd vikhykirsldnggyyispritfpcisdmikhyqkqsdglcrrlekacis
Timeline for d4tzia_: