![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
![]() | Protein automated matches [190202] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187800] (5 PDB entries) |
![]() | Domain d4tzib_: 4tzi B: [271040] automated match to d1blka_ |
PDB Entry: 4tzi (more details), 2.1 Å
SCOPe Domain Sequences for d4tzib_:
Sequence, based on SEQRES records: (download)
>d4tzib_ d.93.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kvntleteewffkditrkdaerqllapgnsagafliresetlkgsfslsvrdydpmhgdv ikhykirsldnggyyispritfpcisdmikhyqkqsdglcrrlekacis
>d4tzib_ d.93.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kvntleteewffkditrkdaerqllapgnsagafliresetlkgsfslsvrdydpmhgdv ikhykirsldggyyispritfpcisdmikhyqkqsdglcrrlekacis
Timeline for d4tzib_: