Lineage for d4twma_ (4twm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2068695Species Dioscorea japonica [TaxId:4673] [271037] (2 PDB entries)
  8. 2068698Domain d4twma_: 4twm A: [271039]
    automated match to d3rg4a_
    complexed with so4

Details for d4twma_

PDB Entry: 4twm (more details), 2.11 Å

PDB Description: crystal structure of dioscorin from dioscorea japonica
PDB Compounds: (A:) Dioscorin 5

SCOPe Domain Sequences for d4twma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4twma_ b.74.1.0 (A:) automated matches {Dioscorea japonica [TaxId: 4673]}
defsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyravda
rlrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesqdq
kravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymgsf
tappctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeqlks

SCOPe Domain Coordinates for d4twma_:

Click to download the PDB-style file with coordinates for d4twma_.
(The format of our PDB-style files is described here.)

Timeline for d4twma_: