SCOPe 2.06: Domain d4twla_: 4twl A:

Lineage for d4twla_ (4twl A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Dioscorea japonica [TaxId:4673] [271037] (2 PDB entries)

8. Domain d4twla_: 4twl A: [271038]
   automated match to d3rg4a_
   complexed with asc, so4

Details for d4twla_

PDB Entry: 4twl, 2.11 Å

PDB Description: crystal structure of dioscorin complexed with ascorbate

PDB Compounds: (A:) Dioscorin 5

SCOPe Domain Sequences for d4twla_:

Sequence; same for both SEQRES and ATOM records:

>d4twla_ b.74.1.0 (A:) automated matches {Dioscorea japonica [TaxId: 4673]}
defsyidgnpngpenwgnlkpewetcgkgmeqspiqlrdnrvifdqtlgklrrnyravda
rlrnsghdvlvdfkgnagslsinrveyqlkrihfhspsehemngerfdleaqlvhesqdq
kravvsilfrfgradpflsdledfikqfsnsqkneinagvvdpnqlqiddsayyrymgsf
tappctegiswtvmrkvatvsprqvlllkqavnenainnarplqptnfrsvfyfeqlks

Timeline for d4twla_:

• d4twla_ first appeared in SCOPe 2.05
  
• d4twla_ appears in SCOPe 2.07
  
• d4twla_ appears in the current release, SCOPe 2.08