Lineage for d4rqra_ (4rqr A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852707Protein automated matches [190442] (13 species)
    not a true protein
  7. 1852739Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)
  8. 1852740Domain d4rqra_: 4rqr A: [271036]
    automated match to d1jhba_
    complexed with com

Details for d4rqra_

PDB Entry: 4rqr (more details), 1.08 Å

PDB Description: crystal structure of human glutaredoxin with mesna
PDB Compounds: (A:) Glutaredoxin-1

SCOPe Domain Sequences for d4rqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqra_ c.47.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtaqefvnckiqpgkvvvfikptcpycrraqeilsqlpikqgllefvditatnhtneiqd
ylqqltgartvprvfigkdciggcsdlvslqqsgelltrlkqigalq

SCOPe Domain Coordinates for d4rqra_:

Click to download the PDB-style file with coordinates for d4rqra_.
(The format of our PDB-style files is described here.)

Timeline for d4rqra_: