Lineage for d4qt5l2 (4qt5 L:108-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1764110Domain d4qt5l2: 4qt5 L:108-211 [271033]
    Other proteins in same PDB: d4qt5a1, d4qt5l1
    automated match to d3mbxl2

Details for d4qt5l2

PDB Entry: 4qt5 (more details), 2.5 Å

PDB Description: crystal structure of 3bd10: a monoclonal antibody against the tsh receptor
PDB Compounds: (L:) 3BD10 mouse monoclonal antibody, light chain

SCOPe Domain Sequences for d4qt5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qt5l2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4qt5l2:

Click to download the PDB-style file with coordinates for d4qt5l2.
(The format of our PDB-style files is described here.)

Timeline for d4qt5l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qt5l1