SCOPe 2.08: Domain d4qt5l2: 4qt5 L:108-211

Lineage for d4qt5l2 (4qt5 L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4qt5l2: 4qt5 L:108-211 [271033]
   Other proteins in same PDB: d4qt5a1, d4qt5b_, d4qt5h_, d4qt5l1
   automated match to d3mbxl2

Details for d4qt5l2

PDB Entry: 4qt5, 2.5 Å

PDB Description: crystal structure of 3bd10: a monoclonal antibody against the tsh receptor

PDB Compounds: (L:) 3BD10 mouse monoclonal antibody, light chain

SCOPe Domain Sequences for d4qt5l2:

Sequence; same for both SEQRES and ATOM records:

>d4qt5l2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4qt5l2:

• d4qt5l2 first appeared in SCOPe 2.05
  
• d4qt5l2 appears in SCOPe 2.07