![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [271028] (1 PDB entry) |
![]() | Domain d4q5fd2: 4q5f D:78-206 [271030] Other proteins in same PDB: d4q5fa1, d4q5fd1 automated match to d2on5a2 complexed with gsh |
PDB Entry: 4q5f (more details), 2.45 Å
SCOPe Domain Sequences for d4q5fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5fd2 a.45.1.0 (D:78-206) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} agktpmeeaqvdsifdqfkdfmaelrpcfrvlagfeegdkekvlkevavpardkhlplle kflaksgseymvgksvtwadlvitdslasweslipdflsghlqlkkyiehvrelpnikkw iaerpktpy
Timeline for d4q5fd2: