Lineage for d4q5na2 (4q5n A:86-232)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736481Species Blomia tropicalis [TaxId:40697] [271008] (1 PDB entry)
  8. 1736482Domain d4q5na2: 4q5n A:86-232 [271020]
    Other proteins in same PDB: d4q5na1, d4q5nb1
    automated match to d3gtub1
    complexed with gsh

Details for d4q5na2

PDB Entry: 4q5n (more details), 2.55 Å

PDB Description: crystal structure of the gluthatione s-transferase blo t 8
PDB Compounds: (A:) Gluthatione S-transferase Blo t 8 isoform

SCOPe Domain Sequences for d4q5na2:

Sequence, based on SEQRES records: (download)

>d4q5na2 a.45.1.0 (A:86-232) automated matches {Blomia tropicalis [TaxId: 40697]}
rangmiattepalsysemieamiidirnrlinvvyaensgtpeefeqkladlrerletsl
gqleaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeel
pslkeyiardehrsasclspfarighr

Sequence, based on observed residues (ATOM records): (download)

>d4q5na2 a.45.1.0 (A:86-232) automated matches {Blomia tropicalis [TaxId: 40697]}
rangmiattepalsysemieamiidirnrlinvvyaetpeefeqkladlrerletslgql
eaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeelpsl
keyiardehrsasclspfarighr

SCOPe Domain Coordinates for d4q5na2:

Click to download the PDB-style file with coordinates for d4q5na2.
(The format of our PDB-style files is described here.)

Timeline for d4q5na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q5na1