Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Blomia tropicalis [TaxId:40697] [271008] (1 PDB entry) |
Domain d4q5na2: 4q5n A:86-232 [271020] Other proteins in same PDB: d4q5na1, d4q5nb1 automated match to d3gtub1 complexed with gsh |
PDB Entry: 4q5n (more details), 2.55 Å
SCOPe Domain Sequences for d4q5na2:
Sequence, based on SEQRES records: (download)
>d4q5na2 a.45.1.0 (A:86-232) automated matches {Blomia tropicalis [TaxId: 40697]} rangmiattepalsysemieamiidirnrlinvvyaensgtpeefeqkladlrerletsl gqleaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeel pslkeyiardehrsasclspfarighr
>d4q5na2 a.45.1.0 (A:86-232) automated matches {Blomia tropicalis [TaxId: 40697]} rangmiattepalsysemieamiidirnrlinvvyaetpeefeqkladlrerletslgql eaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfakvsdymkrfeelpsl keyiardehrsasclspfarighr
Timeline for d4q5na2: