Lineage for d4q5rd2 (4q5r D:78-203)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713854Species Blattella germanica [TaxId:6973] [271001] (1 PDB entry)
  8. 2713858Domain d4q5rd2: 4q5r D:78-203 [271016]
    Other proteins in same PDB: d4q5ra1, d4q5rb1, d4q5rc1, d4q5rd1, d4q5re1, d4q5rf1
    automated match to d3vura2
    complexed with cl, gol, gsh

Details for d4q5rd2

PDB Entry: 4q5r (more details), 2.25 Å

PDB Description: crystal structure of glutathione s-transferase bla g 5
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d4q5rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5rd2 a.45.1.0 (D:78-203) automated matches {Blattella germanica [TaxId: 6973]}
lsgkddwenleidmivdtisdfraaianyhydadenskqkkwdplkketipyytkkfdev
vkanggylaagkltwadfyfvaildylnhmakedlvanqpnlkalrekvlglpaikawva
krpptd

SCOPe Domain Coordinates for d4q5rd2:

Click to download the PDB-style file with coordinates for d4q5rd2.
(The format of our PDB-style files is described here.)

Timeline for d4q5rd2: