![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [271006] (1 PDB entry) |
![]() | Domain d4q5qb2: 4q5q B:88-201 [271014] Other proteins in same PDB: d4q5qa1, d4q5qb1 automated match to d2fhea1 complexed with gsh |
PDB Entry: 4q5q (more details), 1.93 Å
SCOPe Domain Sequences for d4q5qb2:
Sequence, based on SEQRES records: (download)
>d4q5qb2 a.45.1.0 (B:88-201) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} ngsndheeirismaeqqtedmmaamirvcydancdklkpdylkslpdclklmskfvgeha fiaganisyvdfnlyeylchvkvmvpevfgqfenlkryvermeslprvsdyikk
>d4q5qb2 a.45.1.0 (B:88-201) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} ngsndheeirismaeqqtedmmaamirvylkslpdclklmskfvgehafiaganisyvdf nlyeylchvkvmvpevfgqfenlkryvermeslprvsdyikk
Timeline for d4q5qb2: