| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (147 species) not a true protein |
| Species Blattella germanica [TaxId:6973] [270993] (1 PDB entry) |
| Domain d4q5rd1: 4q5r D:2-77 [271013] Other proteins in same PDB: d4q5ra2, d4q5rb2, d4q5rc2, d4q5rd2, d4q5re2, d4q5rf2 automated match to d3vura1 complexed with cl, gol, gsh |
PDB Entry: 4q5r (more details), 2.25 Å
SCOPe Domain Sequences for d4q5rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5rd1 c.47.1.0 (D:2-77) automated matches {Blattella germanica [TaxId: 6973]}
apsykltycpvkalgepirfllsygekdfedyrfqegdwpnlkpsmpfgktpvleidgkq
thqsvaisrylgkqfg
Timeline for d4q5rd1: