SCOPe 2.08: Domain d4q5qa2: 4q5q A:88-219

Lineage for d4q5qa2 (4q5q A:88-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [271006] (1 PDB entry)

8. Domain d4q5qa2: 4q5q A:88-219 [271007]
   Other proteins in same PDB: d4q5qa1, d4q5qb1
   automated match to d2fhea1
   complexed with gsh

Details for d4q5qa2

PDB Entry: 4q5q, 1.93 Å

PDB Description: crystal structure of the glutathione s-transferase der p 8

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4q5qa2:

Sequence; same for both SEQRES and ATOM records:

>d4q5qa2 a.45.1.0 (A:88-219) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
ngsndheeirismaeqqtedmmaamirvcydancdklkpdylkslpdclklmskfvgeha
fiaganisyvdfnlyeylchvkvmvpevfgqfenlkryvermeslprvsdyikkqqpktf
naptskwnasya

Timeline for d4q5qa2:

• d4q5qa2 first appeared in SCOPe 2.05
  
• d4q5qa2 appears in SCOPe 2.07