![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Blattella germanica [TaxId:6973] [271001] (1 PDB entry) |
![]() | Domain d4q5re2: 4q5r E:78-200 [271004] Other proteins in same PDB: d4q5ra1, d4q5rb1, d4q5rc1, d4q5rd1, d4q5re1, d4q5rf1 automated match to d3vura2 complexed with cl, gol, gsh |
PDB Entry: 4q5r (more details), 2.25 Å
SCOPe Domain Sequences for d4q5re2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5re2 a.45.1.0 (E:78-200) automated matches {Blattella germanica [TaxId: 6973]} lsgkddwenleidmivdtisdfraaianyhydadenskqkkwdplkketipyytkkfdev vkanggylaagkltwadfyfvaildylnhmakedlvanqpnlkalrekvlglpaikawva krp
Timeline for d4q5re2: