SCOPe 2.06: Domain d4q5rb2: 4q5r B:78-204

Lineage for d4q5rb2 (4q5r B:78-204)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (61 species)
   not a true protein

7. Species Blattella germanica [TaxId:6973] [271001] (1 PDB entry)

8. Domain d4q5rb2: 4q5r B:78-204 [271003]
   Other proteins in same PDB: d4q5ra1, d4q5rb1, d4q5rc1, d4q5rd1, d4q5re1, d4q5rf1
   automated match to d3vura2
   complexed with cl, gol, gsh

Details for d4q5rb2

PDB Entry: 4q5r, 2.25 Å

PDB Description: crystal structure of glutathione s-transferase bla g 5

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4q5rb2:

Sequence; same for both SEQRES and ATOM records:

>d4q5rb2 a.45.1.0 (B:78-204) automated matches {Blattella germanica [TaxId: 6973]}
lsgkddwenleidmivdtisdfraaianyhydadenskqkkwdplkketipyytkkfdev
vkanggylaagkltwadfyfvaildylnhmakedlvanqpnlkalrekvlglpaikawva
krpptdl

Timeline for d4q5rb2:

• d4q5rb2 first appeared in SCOPe 2.05
  
• d4q5rb2 appears in SCOPe 2.07
  
• d4q5rb2 appears in the current release, SCOPe 2.08