SCOPe 2.08: Domain d4q5qa1: 4q5q A:2-87

Lineage for d4q5qa1 (4q5q A:2-87)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [270996] (1 PDB entry)

8. Domain d4q5qa1: 4q5q A:2-87 [270999]
   Other proteins in same PDB: d4q5qa2, d4q5qb2
   automated match to d2fhea2
   complexed with gsh

Details for d4q5qa1

PDB Entry: 4q5q, 1.93 Å

PDB Description: crystal structure of the glutathione s-transferase der p 8

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4q5qa1:

Sequence; same for both SEQRES and ATOM records:

>d4q5qa1 c.47.1.0 (A:2-87) automated matches {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
sqpilgywdirgyaqpirllltysgvdfvdkryqigpapdfdrsewlnekfnlgldfpnl
pyyidgdmkmtqtfailrylgrkykl

Timeline for d4q5qa1:

• d4q5qa1 first appeared in SCOPe 2.05
  
• d4q5qa1 appears in SCOPe 2.07