SCOPe 2.08: Domain d4q5re1: 4q5r E:5-77

Lineage for d4q5re1 (4q5r E:5-77)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Blattella germanica [TaxId:6973] [270993] (1 PDB entry)

8. Domain d4q5re1: 4q5r E:5-77 [270998]
   Other proteins in same PDB: d4q5ra2, d4q5rb2, d4q5rc2, d4q5rd2, d4q5re2, d4q5rf2
   automated match to d3vura1
   complexed with cl, gol, gsh

Details for d4q5re1

PDB Entry: 4q5r, 2.25 Å

PDB Description: crystal structure of glutathione s-transferase bla g 5

PDB Compounds: (E:) glutathione s-transferase

SCOPe Domain Sequences for d4q5re1:

Sequence, based on SEQRES records:

>d4q5re1 c.47.1.0 (E:5-77) automated matches {Blattella germanica [TaxId: 6973]}
ykltycpvkalgepirfllsygekdfedyrfqegdwpnlkpsmpfgktpvleidgkqthq
svaisrylgkqfg

Sequence, based on observed residues (ATOM records):

>d4q5re1 c.47.1.0 (E:5-77) automated matches {Blattella germanica [TaxId: 6973]}
ykltylgepirfllsygekdfedyrwpnlkpsmpfgktpvleidgkqthqsvaisrylgk
qfg

Timeline for d4q5re1:

• d4q5re1 first appeared in SCOPe 2.05
  
• d4q5re1 appears in SCOPe 2.07