SCOPe 2.06: Domain d4oy9a2: 4oy9 A:102-213

Lineage for d4oy9a2 (4oy9 A:102-213)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.0: automated matches [191376] (1 protein)
   not a true family

6. Protein automated matches [190458] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255601] (16 PDB entries)

8. Domain d4oy9a2: 4oy9 A:102-213 [270990]
   automated match to d1ff5a2
   complexed with ca

Details for d4oy9a2

PDB Entry: 4oy9, 1.62 Å

PDB Description: crystal structure of human p-cadherin ec1-ec2 in closed conformation

PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d4oy9a2:

Sequence; same for both SEQRES and ATOM records:

>d4oy9a2 b.1.6.0 (A:102-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndhkpkftqdtfrgsvlegvlpgtsvmqvtatdeddaiytyngvvaysihsqepkdphdl
mftihrstgtisvissgldrekvpeytltiqatdmdgdgstttavavveild

Timeline for d4oy9a2:

• d4oy9a2 first appeared in SCOPe 2.05
  
• d4oy9a2 appears in SCOPe 2.07
  
• d4oy9a2 appears in the current release, SCOPe 2.08